PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC5481_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 240aa    MW: 26779.2 Da    PI: 9.6112
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC5481_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.13.4e-373694462
      zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                  lkcprCds ntkfCyynnyslsqPr++Ck+CrryWt+GGalrnvP+Gg++r+++k s
  RrC5481_p1 36 PVLKCPRCDSVNTKFCYYNNYSLSQPRHYCKNCRRYWTRGGALRNVPIGGSTRNKNKPS 94
                5789*************************************************988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-303292IPR003851Zinc finger, Dof-type
PfamPF027015.6E-323792IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2483892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010227Biological Processfloral organ abscission
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MMPSSHQSHT TSFKPPRIKK PPHQISRMGQ SPAVQPVLKC PRCDSVNTKF CYYNNYSLSQ  60
PRHYCKNCRR YWTRGGALRN VPIGGSTRNK NKPSSLQVMS SPPPIVAPLS SHELADGFRM  120
NRAHIDPPAM AFSGGFSGYM LPLDPNYNLA SSSIESLSSL NQDLHQKLQQ QRLIASMFQQ  180
DSPPVMFHNA ELLTPSTATT EWVFDRSAMG GAAACGINEN NDDREGNLRS WYHNPNNSMP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00478DAPTransfer from AT4G38000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013732610.11e-144PREDICTED: dof zinc finger protein DOF4.7-like
RefseqXP_013736532.11e-144PREDICTED: dof zinc finger protein DOF4.7-like
SwissprotQ84K521e-111DOF47_ARATH; Dof zinc finger protein DOF4.7
TrEMBLA0A078CI061e-144A0A078CI06_BRANA; BnaA01g00130D protein
STRINGBra011800.1-P1e-142(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152861518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38000.11e-109DNA binding with one finger 4.7